PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa016798
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family ARR-B
Protein Properties Length: 511aa    MW: 55912.8 Da    PI: 6.4524
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-27895PU_refplantGDBView CDS
gnl|UG|Lsa#S58693565PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like902.1e-28222275155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                kpr++W+ eLH++Fv+av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQk+Rl
  Lsa016798 222 KPRVVWSVELHQQFVSAVNQL-GIDKAVPKRILELMNVPGLTRENVASHLQKFRL 275
                79*******************.********************************8 PP

2Response_reg55.33.7e-19341431109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+  + + + + +++  ++  +  ++   al++l+e++  +D++l D+ mp+mdG++ll+     e++lp+i+++a g  +++l+ ++ Ga 
     Lsa016798  34 VLVVDDDXYLFKDFGTNASQMLVSCYNLLTSNWLALNILRERKggFDVVLSDVHMPDMDGFKLLELVGL-EMDLPVIMMSADGRTNLVLRGIRHGAC 129
                   78898888888888888888888566688899999****999999*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +e+l +
     Lsa016798 130 DYLIKPIREEQLKN 143
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521724.98E-2731157IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23004.0E-3031161No hitNo description
SMARTSM004481.5E-1832145IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011030.84133149IPR001789Signal transduction response regulator, receiver domain
PfamPF000727.2E-1634143IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.57E-1935149No hitNo description
PROSITE profilePS5129410.898219278IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-30219280IPR009057Homeodomain-like
SuperFamilySSF466891.29E-19220279IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-24222275IPR006447Myb domain, plants
PfamPF002496.8E-7224273IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MTTASSFVSG SGSGSLSSKP ATGVSDQFPV GLRVLVVDDD XYLFKDFGTN ASQMLVSCYN  60
LLTSNWLALN ILRERKGGFD VVLSDVHMPD MDGFKLLELV GLEMDLPVIM MSADGRTNLV  120
LRGIRHGACD YLIKPIREEQ LKNIWQHVIR KKWNENKEHE NSGSMEHKRG GGGGDDNHDS  180
EYGSSVNEGG ENGLLTCHKK RRSIKEEDDC ELESDDPSAS KKPRVVWSVE LHQQFVSAVN  240
QLGIDKAVPK RILELMNVPG LTRENVASHL QKFRLYLKRL SGVGGQQGGG QNSFCGPIEQ  300
NKKLGLYGRF EIQALAASGQ IPPETLAALH AELFGRPTGN VNLPLVDHQP ILQSSNYGQP  360
LPSKQISQPV VEDVHSWHSN NMIGNYGGLG GQNGNLIGVM PSQQVQKQAI TVQPSRLVVP  420
NNQSSSVSFQ GGNSGVLVNS GEKQISFGEC VQVLDQGPLR NLGFVGKGNS IPSRFAVYED  480
ESLANNLNQW DNFGKKVKQE PNIEFMSVFS E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-24218281164ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010651276.11e-180PREDICTED: two-component response regulator ARR1 isoform X1
SwissprotA2XE311e-124ORR21_ORYSI; Two-component response regulator ORR21
SwissprotQ8H7S71e-124ORR21_ORYSJ; Two-component response regulator ORR21
TrEMBLA0A118K1J30.0A0A118K1J3_CYNCS; CheY-like superfamily
STRINGVIT_01s0011g05830.t011e-173(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-96response regulator 2